PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017894
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MYB_related
Protein Properties Length: 269aa    MW: 29439.6 Da    PI: 7.13
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-48210PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.4e-1489133347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
        Lsa017894  89 PWTEEEHRLFLVGLNKVGKGDWRGISRNFVKTRTPTQVASHAQKY 133
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.17282138IPR017930Myb domain
SuperFamilySSF466891.44E-1784138IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-1685136IPR006447Myb domain, plants
SMARTSM007171.9E-1086136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-1188133IPR009057Homeodomain-like
CDDcd001671.23E-989134No hitNo description
PfamPF002493.2E-1189133IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAAMPGSCLE STGSTTTSSS PVNNIGKSIM LFGVRLMEGG SSFRKSASMN NLAQFDCQPP  60
DSNTDAAGYA SDDVIHPSAR CQDRKRGVPW TEEEHRLFLV GLNKVGKGDW RGISRNFVKT  120
RTPTQVASHA QKYFLRRNNN NNRRRRRSSL FDITTETYTN SSPEDEEKQP LSLLPATTGD  180
DNSVMSPSTR VLMPPSTKMA NLNLNSTEEE EEIDHQPSSL ALTLHLSLQH QPSTSSPPPT  240
NSNTMAKFQD ISGSFNNNSG DANTIISVA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438523.14e-74hypothetical protein CICLE_v10032167mg
RefseqXP_006483742.15e-74PREDICTED: transcription factor MYB1R1 isoform X2
SwissprotQ2V9B01e-39MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A067GVG88e-75A0A067GVG8_CITSI; Uncharacterized protein
STRINGGLYMA02G03020.12e-64(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.28e-64MYB_related family protein